Lineage for d2p9ng_ (2p9n G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340383Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
    automatically mapped to Pfam PF04699
  5. 2340384Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)
  6. 2340390Protein automated matches [190348] (1 species)
    not a true protein
  7. 2340391Species Cow (Bos taurus) [TaxId:9913] [187175] (14 PDB entries)
  8. 2340404Domain d2p9ng_: 2p9n G: [139613]
    Other proteins in same PDB: d2p9na1, d2p9na2, d2p9nb_, d2p9nc_, d2p9nd1, d2p9nd2, d2p9ne_, d2p9nf_
    automated match to d1k8kg_
    complexed with adp, ca

Details for d2p9ng_

PDB Entry: 2p9n (more details), 2.85 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp
PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOPe Domain Sequences for d2p9ng_:

Sequence, based on SEQRES records: (download)

>d2p9ng_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d2p9ng_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdagpdegevdsclrqgnmtaalqaalknppintksqavkdrag
sivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdssavllqwhekalaagg
vgsivrvltarktv

SCOPe Domain Coordinates for d2p9ng_:

Click to download the PDB-style file with coordinates for d2p9ng_.
(The format of our PDB-style files is described here.)

Timeline for d2p9ng_: