Lineage for d2p9nf1 (2p9n F:2-168)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739594Fold d.198: Secretion chaperone-like [69634] (3 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 739658Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 739659Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 739682Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 739683Species Cow (Bos taurus) [TaxId:9913] [69648] (10 PDB entries)
  8. 739692Domain d2p9nf1: 2p9n F:2-168 [139612]
    Other proteins in same PDB: d2p9na1, d2p9na2, d2p9nc1, d2p9nd1, d2p9nd2, d2p9ne1, d2p9ng1
    automatically matched to d1k8kf_
    complexed with adp, ca

Details for d2p9nf1

PDB Entry: 2p9n (more details), 2.85 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp
PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOP Domain Sequences for d2p9nf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9nf1 d.198.2.1 (F:2-168) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOP Domain Coordinates for d2p9nf1:

Click to download the PDB-style file with coordinates for d2p9nf1.
(The format of our PDB-style files is described here.)

Timeline for d2p9nf1: