SCOP 1.73: Domain d2p9nd1: 2p9n D:1-120

Lineage for d2p9nd1 (2p9n D:1-120)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.198: Secretion chaperone-like [69634] (3 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)

5. Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)

6. Protein ARPC2 (34 kDa subunit) [69649] (1 species)
   duplication: tandem repeat of two domains of this fold

7. Species Cow (Bos taurus) [TaxId:9913] [69650] (10 PDB entries)

8. Domain d2p9nd1: 2p9n D:1-120 [139609]
   Other proteins in same PDB: d2p9na1, d2p9na2, d2p9nc1, d2p9ne1, d2p9nf1, d2p9ng1
   automatically matched to d1k8kd1
   complexed with adp, ca

Details for d2p9nd1

PDB Entry: 2p9n, 2.85 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp

PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOP Domain Sequences for d2p9nd1:

Sequence; same for both SEQRES and ATOM records:

>d2p9nd1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

Timeline for d2p9nd1:

• d2p9nd1 is new in SCOP 1.73
  
• d2p9nd1 appears in SCOP 1.75
  
• d2p9nd1 appears in the current release, SCOPe 2.08