Lineage for d2p9nc_ (2p9n C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2065972Family b.69.4.1: WD40-repeat [50979] (13 protein domains)
  6. 2066073Protein automated matches [190346] (4 species)
    not a true protein
  7. 2066074Species Cow (Bos taurus) [TaxId:9913] [187173] (14 PDB entries)
  8. 2066084Domain d2p9nc_: 2p9n C: [139608]
    Other proteins in same PDB: d2p9na1, d2p9na2, d2p9nb_, d2p9nd1, d2p9nd2, d2p9ne_, d2p9nf_, d2p9ng_
    automated match to d1tyqc_
    complexed with adp, ca

Details for d2p9nc_

PDB Entry: 2p9n (more details), 2.85 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp
PDB Compounds: (C:) Actin-related protein 2/3 complex subunit 1B

SCOPe Domain Sequences for d2p9nc_:

Sequence, based on SEQRES records: (download)

>d2p9nc_ b.69.4.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdwa
pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla
setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltarer
fqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvrs
lesalkdlkiv

Sequence, based on observed residues (ATOM records): (download)

>d2p9nc_ b.69.4.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdwa
pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla
setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpagldslhknsvsq
isvlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv

SCOPe Domain Coordinates for d2p9nc_:

Click to download the PDB-style file with coordinates for d2p9nc_.
(The format of our PDB-style files is described here.)

Timeline for d2p9nc_: