Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Actin-related protein 3, Arp3 [69528] (1 species) part of Arp2/3 complex |
Species Cow (Bos taurus) [TaxId:9913] [69529] (10 PDB entries) |
Domain d2p9na1: 2p9n A:3-160 [139606] Other proteins in same PDB: d2p9nc1, d2p9nd1, d2p9nd2, d2p9ne1, d2p9nf1, d2p9ng1 automatically matched to d1tyqa1 complexed with adp, ca |
PDB Entry: 2p9n (more details), 2.85 Å
SCOP Domain Sequences for d2p9na1:
Sequence, based on SEQRES records: (download)
>d2p9na1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen reytaeimfesfnvpglyiavqavlalaaswtsrqvge
>d2p9na1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} grlpacvvdcgtgytklgyagntepqfiipsciaikemkgvddldffigdeaiekptyat kwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfesf nvpglyiavqavlalaaswtsvge
Timeline for d2p9na1: