SCOP 1.73: Domain d2p9lf1: 2p9l F:3-168

Lineage for d2p9lf1 (2p9l F:3-168)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.198: Secretion chaperone-like [69634] (3 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)

5. Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)

6. Protein ARPC4 (20 kDa subunit) [69647] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [69648] (10 PDB entries)

8. Domain d2p9lf1: 2p9l F:3-168 [139604]
   Other proteins in same PDB: d2p9la1, d2p9la2, d2p9lc1, d2p9ld1, d2p9ld2, d2p9le1, d2p9lg1
   automatically matched to d1k8kf_

Details for d2p9lf1

PDB Entry: 2p9l, 2.65 Å

PDB Description: crystal structure of bovine arp2/3 complex

PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOP Domain Sequences for d2p9lf1:

Sequence; same for both SEQRES and ATOM records:

>d2p9lf1 d.198.2.1 (F:3-168) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl
iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh
teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

Timeline for d2p9lf1:

• d2p9lf1 is new in SCOP 1.73
  
• d2p9lf1 appears in SCOP 1.75
  
• d2p9lf1 appears in the current release, SCOPe 2.08, called d2p9lf_