Class a: All alpha proteins [46456] (284 folds) |
Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) automatically mapped to Pfam PF04062 |
Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins) |
Protein automated matches [190347] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187174] (11 PDB entries) |
Domain d2p9le_: 2p9l E: [139603] Other proteins in same PDB: d2p9la1, d2p9la2, d2p9lb_, d2p9lc_, d2p9ld1, d2p9ld2, d2p9lf_, d2p9lg_ automated match to d1k8ke_ |
PDB Entry: 2p9l (more details), 2.65 Å
SCOPe Domain Sequences for d2p9le_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9le_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls
Timeline for d2p9le_: