Lineage for d2p9kg_ (2p9k G:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096616Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
  5. 1096617Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)
  6. 1096623Protein automated matches [190348] (1 species)
    not a true protein
  7. 1096624Species Cow (Bos taurus) [TaxId:9913] [187175] (12 PDB entries)
  8. 1096627Domain d2p9kg_: 2p9k G: [139597]
    Other proteins in same PDB: d2p9ka1, d2p9ka2, d2p9kc_, d2p9kd1, d2p9kd2, d2p9ke_, d2p9kf_
    automated match to d1k8kg_
    complexed with atp, ca

Details for d2p9kg_

PDB Entry: 2p9k (more details), 2.59 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with atp and crosslinked with glutaraldehyde
PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOPe Domain Sequences for d2p9kg_:

Sequence, based on SEQRES records: (download)

>d2p9kg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d2p9kg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdeagpdegevdsclrqgnmtaalqaalknppintksqavkdra
gsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekalaa
ggvgsivrvltarktv

SCOPe Domain Coordinates for d2p9kg_:

Click to download the PDB-style file with coordinates for d2p9kg_.
(The format of our PDB-style files is described here.)

Timeline for d2p9kg_: