Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) |
Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins) |
Protein ARPC4 (20 kDa subunit) [69647] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [69648] (14 PDB entries) Uniprot P59998 # 100% sequence identity |
Domain d2p9kf_: 2p9k F: [139596] Other proteins in same PDB: d2p9ka1, d2p9ka2, d2p9kc_, d2p9kd1, d2p9kd2, d2p9ke_, d2p9kg_ automated match to d1k8kf_ complexed with atp, ca |
PDB Entry: 2p9k (more details), 2.59 Å
SCOPe Domain Sequences for d2p9kf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9kf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]} tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
Timeline for d2p9kf_: