Lineage for d2p9ka1 (2p9k A:3-160)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701286Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 701429Protein Actin-related protein 3, Arp3 [69528] (1 species)
    part of Arp2/3 complex
  7. 701430Species Cow (Bos taurus) [TaxId:9913] [69529] (10 PDB entries)
  8. 701437Domain d2p9ka1: 2p9k A:3-160 [139590]
    Other proteins in same PDB: d2p9kc1, d2p9kd1, d2p9kd2, d2p9ke1, d2p9kf1, d2p9kg1
    automatically matched to d1tyqa1
    complexed with atp, ca

Details for d2p9ka1

PDB Entry: 2p9k (more details), 2.59 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with atp and crosslinked with glutaraldehyde
PDB Compounds: (A:) actin-like protein 3

SCOP Domain Sequences for d2p9ka1:

Sequence, based on SEQRES records: (download)

>d2p9ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi
gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen
reytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records): (download)

>d2p9ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikemkgvddldffigdeaiekptyat
kwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfesf
nvpglyiavqavlalaaswtsvge

SCOP Domain Coordinates for d2p9ka1:

Click to download the PDB-style file with coordinates for d2p9ka1.
(The format of our PDB-style files is described here.)

Timeline for d2p9ka1: