Lineage for d2p9ie_ (2p9i E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017382Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 2017383Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
    automatically mapped to Pfam PF04062
  5. 2017384Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)
  6. 2017392Protein automated matches [190347] (1 species)
    not a true protein
  7. 2017393Species Cow (Bos taurus) [TaxId:9913] [187174] (12 PDB entries)
  8. 2017394Domain d2p9ie_: 2p9i E: [139587]
    Other proteins in same PDB: d2p9ia1, d2p9ia2, d2p9ic_, d2p9id1, d2p9id2, d2p9if_, d2p9ig_
    automated match to d1k8ke_
    complexed with adp, ca

Details for d2p9ie_

PDB Entry: 2p9i (more details), 2.46 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp and crosslinked with gluteraldehyde
PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOPe Domain Sequences for d2p9ie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9ie_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg

SCOPe Domain Coordinates for d2p9ie_:

Click to download the PDB-style file with coordinates for d2p9ie_.
(The format of our PDB-style files is described here.)

Timeline for d2p9ie_: