| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) ![]() |
| Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (1 protein) |
| Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [69063] (10 PDB entries) Uniprot O15145 # 100% sequence identity |
| Domain d2p9ie1: 2p9i E:2-175 [139587] Other proteins in same PDB: d2p9ia1, d2p9ia2, d2p9ic1, d2p9id1, d2p9id2, d2p9if1, d2p9ig1 automatically matched to d1k8ke_ complexed with adp, ca |
PDB Entry: 2p9i (more details), 2.46 Å
SCOP Domain Sequences for d2p9ie1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9ie1 a.148.1.1 (E:2-175) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
Timeline for d2p9ie1: