Lineage for d2p9id1 (2p9i D:1-120)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739594Fold d.198: Secretion chaperone-like [69634] (3 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 739658Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 739659Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 739660Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 739661Species Cow (Bos taurus) [TaxId:9913] [69650] (10 PDB entries)
  8. 739664Domain d2p9id1: 2p9i D:1-120 [139585]
    Other proteins in same PDB: d2p9ia1, d2p9ia2, d2p9ic1, d2p9ie1, d2p9if1, d2p9ig1
    automatically matched to d1k8kd1
    complexed with adp, ca

Details for d2p9id1

PDB Entry: 2p9i (more details), 2.46 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp and crosslinked with gluteraldehyde
PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOP Domain Sequences for d2p9id1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9id1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

SCOP Domain Coordinates for d2p9id1:

Click to download the PDB-style file with coordinates for d2p9id1.
(The format of our PDB-style files is described here.)

Timeline for d2p9id1: