![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
![]() | Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53838] (11 PDB entries) |
![]() | Domain d2p9hb_: 2p9h B: [139581] automated match to d2p9ha1 complexed with ipt |
PDB Entry: 2p9h (more details), 2 Å
SCOPe Domain Sequences for d2p9hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9hb_ c.93.1.1 (B:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv drllqlsqgqavkgnqllpvslvkrkttl
Timeline for d2p9hb_: