Lineage for d2p9hb1 (2p9h B:62-330)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 845996Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 845997Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 845998Family c.93.1.1: L-arabinose binding protein-like [53823] (16 proteins)
  6. 846093Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 846094Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)
  8. 846097Domain d2p9hb1: 2p9h B:62-330 [139581]
    automatically matched to d1jyea_
    complexed with ipt

Details for d2p9hb1

PDB Entry: 2p9h (more details), 2 Å

PDB Description: high resolution structure of the lactose repressor bound to iptg
PDB Compounds: (B:) lactose operon repressor

SCOP Domain Sequences for d2p9hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9hb1 c.93.1.1 (B:62-330) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttl

SCOP Domain Coordinates for d2p9hb1:

Click to download the PDB-style file with coordinates for d2p9hb1.
(The format of our PDB-style files is described here.)

Timeline for d2p9hb1: