SCOPe 2.08: Domain d2p9ha_: 2p9h A:

Lineage for d2p9ha_ (2p9h A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)

7. Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)

8. Domain d2p9ha_: 2p9h A: [139580]
   automated match to d2p9ha1
   complexed with ipt

Details for d2p9ha_

PDB Entry: 2p9h, 2 Å

PDB Description: high resolution structure of the lactose repressor bound to iptg

PDB Compounds: (A:) lactose operon repressor

SCOPe Domain Sequences for d2p9ha_:

Sequence; same for both SEQRES and ATOM records:

>d2p9ha_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttl

Timeline for d2p9ha_:

• d2p9ha_ first appeared in SCOP 1.73, called d2p9ha1
  
• d2p9ha_ appears in SCOPe 2.07