SCOPe 2.07: Domain d2p9ga3: 2p9g A:327-410

Lineage for d2p9ga3 (2p9g A:327-410)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein)

6. Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species)

7. Species Escherichia coli [TaxId:562] [55024] (7 PDB entries)

8. Domain d2p9ga3: 2p9g A:327-410 [139576]
   Other proteins in same PDB: d2p9ga1, d2p9ga2, d2p9gb1, d2p9gb2
   automatically matched to d1psda3
   complexed with nai, ser; mutant

Details for d2p9ga3

PDB Entry: 2p9g, 2.8 Å

PDB Description: crystal structure of serine bound g336v,g337v double mutant of e.coli phosphoglycerate dehydrogenase

PDB Compounds: (A:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d2p9ga3:

Sequence; same for both SEQRES and ATOM records:

>d2p9ga3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]}
fpevslplhvvrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead
edvaekalqamkaipgtirarlly

Timeline for d2p9ga3:

• d2p9ga3 first appeared in SCOP 1.73
  
• d2p9ga3 appears in SCOPe 2.06
  
• d2p9ga3 appears in the current release, SCOPe 2.08