![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein) |
![]() | Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55024] (7 PDB entries) |
![]() | Domain d2p9ga3: 2p9g A:327-410 [139576] Other proteins in same PDB: d2p9ga1, d2p9ga2, d2p9gb1, d2p9gb2 automatically matched to d1psda3 complexed with nai, ser; mutant |
PDB Entry: 2p9g (more details), 2.8 Å
SCOPe Domain Sequences for d2p9ga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9ga3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} fpevslplhvvrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead edvaekalqamkaipgtirarlly
Timeline for d2p9ga3: