![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
![]() | Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins) this domain is interrupted by the Rossmann-fold domain |
![]() | Protein Phosphoglycerate dehydrogenase [52293] (2 species) has additional C-terminal domain of the ferredoxin fold |
![]() | Species Escherichia coli [TaxId:562] [52294] (7 PDB entries) |
![]() | Domain d2p9ga2: 2p9g A:7-107,A:296-326 [139575] Other proteins in same PDB: d2p9ga1, d2p9ga3, d2p9gb1, d2p9gb3 automatically matched to d1psda2 complexed with nai, ser; mutant |
PDB Entry: 2p9g (more details), 2.8 Å
SCOPe Domain Sequences for d2p9ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9ga2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsXstqeaqeniglevagkli kysdngstlsavn
Timeline for d2p9ga2: