Lineage for d2p9ea3 (2p9e A:327-410)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910214Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 1910215Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein)
  6. 1910216Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species)
  7. 1910217Species Escherichia coli [TaxId:562] [55024] (7 PDB entries)
  8. 1910230Domain d2p9ea3: 2p9e A:327-410 [139564]
    Other proteins in same PDB: d2p9ea1, d2p9ea2, d2p9eb1, d2p9eb2, d2p9ec1, d2p9ec2, d2p9ed1, d2p9ed2
    automatically matched to d1psda3
    complexed with cit, nai, po4, so4; mutant

Details for d2p9ea3

PDB Entry: 2p9e (more details), 2.6 Å

PDB Description: crystal structure of g336v mutant of e.coli phosphoglycerate dehydrogenase
PDB Compounds: (A:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d2p9ea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9ea3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]}
fpevslplhvgrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead
edvaekalqamkaipgtirarlly

SCOPe Domain Coordinates for d2p9ea3:

Click to download the PDB-style file with coordinates for d2p9ea3.
(The format of our PDB-style files is described here.)

Timeline for d2p9ea3: