SCOPe 2.08: Domain d2p9cb2: 2p9c B:7-107,B:296-326

Lineage for d2p9cb2 (2p9c B:7-107,B:296-326)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
   this domain is interrupted by the Rossmann-fold domain

6. Protein Phosphoglycerate dehydrogenase [52293] (2 species)
   has additional C-terminal domain of the ferredoxin fold

7. Species Escherichia coli [TaxId:562] [52294] (7 PDB entries)

8. Domain d2p9cb2: 2p9c B:7-107,B:296-326 [139560]
   Other proteins in same PDB: d2p9ca1, d2p9ca3, d2p9cb1, d2p9cb3
   automatically matched to d1psda2
   complexed with nai, ser; mutant

Details for d2p9cb2

PDB Entry: 2p9c, 2.46 Å

PDB Description: crystal structure of serine bound g336v mutant of e.coli phosphoglycerate dehydrogenase

PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d2p9cb2:

Sequence; same for both SEQRES and ATOM records:

>d2p9cb2 c.23.12.1 (B:7-107,B:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsXstqeaqeniglevagkli
kysdngstlsavn

Timeline for d2p9cb2:

• d2p9cb2 first appeared in SCOP 1.73
  
• d2p9cb2 appears in SCOPe 2.07