SCOPe 2.07: Domain d2p9cb1: 2p9c B:108-295

Lineage for d2p9cb1 (2p9c B:108-295)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Phosphoglycerate dehydrogenase [51839] (2 species)
   has additional C-terminal domain of the ferredoxin fold

7. Species Escherichia coli [TaxId:562] [51840] (7 PDB entries)

8. Domain d2p9cb1: 2p9c B:108-295 [139559]
   Other proteins in same PDB: d2p9ca2, d2p9ca3, d2p9cb2, d2p9cb3
   automatically matched to d1psda1
   complexed with nai, ser; mutant

Details for d2p9cb1

PDB Entry: 2p9c, 2.46 Å

PDB Description: crystal structure of serine bound g336v mutant of e.coli phosphoglycerate dehydrogenase

PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d2p9cb1:

Sequence; same for both SEQRES and ATOM records:

>d2p9cb1 c.2.1.4 (B:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ntrsvaelvigelllllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlg
ilaeslgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeis
lmkpgsllinasrgtvvdipaladalaskhlagaaidvfptepatnsdpftsplaefdnv
lltphigg

Timeline for d2p9cb1:

• d2p9cb1 first appeared in SCOP 1.73
  
• d2p9cb1 appears in SCOPe 2.06
  
• d2p9cb1 appears in the current release, SCOPe 2.08