SCOPe 2.01: Domain d2p8zt5: 2p8z T:730-842

Lineage for d2p8zt5 (2p8z T:730-842)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
   domain III structure is lacking some of the superfamily characters and is often disordered in crystals

6. Protein Elongation factor 2 (eEF-2) [82677] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries)
   Uniprot P32324

8. Domain d2p8zt5: 2p8z T:730-842 [139555]
   Other proteins in same PDB: d2p8zt1, d2p8zt2, d2p8zt3
   automatically matched to d1n0ua5
   complexed with apr, gnp, so1

Details for d2p8zt5

PDB Entry: 2p8z, 8.9 Å

PDB Description: fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdpnp:sordarin cryo-em reconstruction

PDB Compounds: (T:) Elongation factor 2

SCOPe Domain Sequences for d2p8zt5:

Sequence, based on SEQRES records:

>d2p8zt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatg
gqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Sequence, based on observed residues (ATOM records):

>d2p8zt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lveiqcpeqavggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqatggqa
fpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Timeline for d2p8zt5:

• d2p8zt5 first appeared in SCOP 1.73
  
• d2p8zt5 appears in SCOP 1.75
  
• d2p8zt5 appears in SCOPe 2.02
  
• d2p8zt5 appears in the current release, SCOPe 2.07