| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) ![]() |
| Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
| Protein Elongation factor 2 (eEF-2) [82677] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries) Uniprot P32324 |
| Domain d2p8yt4: 2p8y T:482-560 [139549] Other proteins in same PDB: d2p8yt1, d2p8yt2, d2p8yt3 automatically matched to d1n0ua4 complexed with apr, dde, gdp, so1 |
PDB Entry: 2p8y (more details), 11.7 Å
SCOP Domain Sequences for d2p8yt4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p8yt4 d.58.11.1 (T:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic
lqdlehdhagvplkisppv
Timeline for d2p8yt4:
View in 3DDomains from same chain: (mouse over for more information) d2p8yt1, d2p8yt2, d2p8yt3, d2p8yt5 |