Lineage for d2p8xt3 (2p8x T:561-724)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1401401Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1401402Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species)
  7. 1401403Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (16 PDB entries)
    Uniprot P32324
  8. 1401433Domain d2p8xt3: 2p8x T:561-724 [139543]
    Other proteins in same PDB: d2p8xt1, d2p8xt2, d2p8xt4, d2p8xt5
    automatically matched to d1n0ua3
    complexed with apr, gnp

Details for d2p8xt3

PDB Entry: 2p8x (more details), 9.7 Å

PDB Description: fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdpnp cryo-em reconstruction
PDB Compounds: (T:) Elongation factor 2

SCOPe Domain Sequences for d2p8xt3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8xt3 d.14.1.1 (T:561-724) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpki

SCOPe Domain Coordinates for d2p8xt3:

Click to download the PDB-style file with coordinates for d2p8xt3.
(The format of our PDB-style files is described here.)

Timeline for d2p8xt3: