SCOPe 2.08: Domain d2p8xt3: 2p8x T:561-724

Lineage for d2p8xt3 (2p8x T:561-724)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (5 proteins)

6. Protein Elongation factor 2 (eEF-2), domain IV [82575] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries)
   Uniprot P32324

8. Domain d2p8xt3: 2p8x T:561-724 [139543]
   Other proteins in same PDB: d2p8xt1, d2p8xt2, d2p8xt4, d2p8xt5
   automatically matched to d1n0ua3
   complexed with apr, gnp
   has additional insertions and/or extensions that are not grouped together

Details for d2p8xt3

PDB Entry: 2p8x, 9.7 Å

PDB Description: fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdpnp cryo-em reconstruction

PDB Compounds: (T:) Elongation factor 2

SCOPe Domain Sequences for d2p8xt3:

Sequence; same for both SEQRES and ATOM records:

>d2p8xt3 d.14.1.1 (T:561-724) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpki

Timeline for d2p8xt3:

• d2p8xt3 first appeared in SCOP 1.73
  
• d2p8xt3 appears in SCOPe 2.07