![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor 2 (eEF-2), N-terminal (G) domain [82404] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82405] (13 PDB entries) Uniprot P32324 |
![]() | Domain d2p8xt2: 2p8x T:3-343 [139542] Other proteins in same PDB: d2p8xt1, d2p8xt3, d2p8xt4, d2p8xt5 automatically matched to d1n0vc2 complexed with apr, gnp has additional subdomain(s) that are not in the common domain |
PDB Entry: 2p8x (more details), 9.7 Å
SCOPe Domain Sequences for d2p8xt2:
Sequence, based on SEQRES records: (download)
>d2p8xt2 c.37.1.8 (T:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrkd eqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrvt dgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfartv esvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmd rlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvllek leivlkgdekdlegkallkvvmrkflpaadallemivlhlp
>d2p8xt2 c.37.1.8 (T:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislyse msdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqte tvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgdv qvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtnk dtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkall kvvmrkflpaadallemivlhlp
Timeline for d2p8xt2:
![]() Domains from same chain: (mouse over for more information) d2p8xt1, d2p8xt3, d2p8xt4, d2p8xt5 |