Lineage for d2p8xt2 (2p8x T:3-343)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein Elongation factor 2 (eEF-2), N-terminal (G) domain [82404] (2 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82405] (13 PDB entries)
    Uniprot P32324
  8. Domain d2p8xt2: 2p8x T:3-343 [139542]
    Other proteins in same PDB: d2p8xt1, d2p8xt3, d2p8xt4, d2p8xt5
    automatically matched to d1n0vc2
    complexed with apr, gnp

    has additional subdomain(s) that are not in the common domain

Details for d2p8xt2

PDB Entry: 2p8x (more details), 9.7 Å

PDB Description: fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdpnp cryo-em reconstruction
PDB Compounds: (T:) Elongation factor 2

SCOPe Domain Sequences for d2p8xt2:

Sequence, based on SEQRES records: (download)

>d2p8xt2 c.37.1.8 (T:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrkd
eqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrvt
dgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfartv
esvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmd
rlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvllek
leivlkgdekdlegkallkvvmrkflpaadallemivlhlp

Sequence, based on observed residues (ATOM records): (download)

>d2p8xt2 c.37.1.8 (T:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislyse
msdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqte
tvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgdv
qvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtnk
dtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkall
kvvmrkflpaadallemivlhlp

SCOPe Domain Coordinates for d2p8xt2 are not available.

Timeline for d2p8xt2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p8xt1, d2p8xt3, d2p8xt4, d2p8xt5