![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (11 proteins) |
![]() | Protein Elongation factor 2 (eEF-2), domain II [82118] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries) Uniprot P32324 |
![]() | Domain d2p8wt1: 2p8w T:344-481 [139536] Other proteins in same PDB: d2p8wt2, d2p8wt3, d2p8wt4, d2p8wt5 automatically matched to d1n0ua1 complexed with gnp |
PDB Entry: 2p8w (more details), 11.3 Å
SCOPe Domain Sequences for d2p8wt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p8wt1 b.43.3.1 (T:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl lktgtlttsetahnmkvm
Timeline for d2p8wt1:
![]() Domains from same chain: (mouse over for more information) d2p8wt2, d2p8wt3, d2p8wt4, d2p8wt5 |