Lineage for d2p8mb1 (2p8m B:1-113)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2017323Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2017327Species Engineered (including hybrid species) [88562] (68 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 2017395Domain d2p8mb1: 2p8m B:1-113 [139528]
    Other proteins in same PDB: d2p8mb2
    automatically matched to d2f5ah1

Details for d2p8mb1

PDB Entry: 2p8m (more details), 2.7 Å

PDB Description: crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide elleldkwaslwn in new crystal form
PDB Compounds: (B:) nmAb 2F5, heavy chain

SCOPe Domain Sequences for d2p8mb1:

Sequence, based on SEQRES records: (download)

>d2p8mb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
vwgqgitvtiss

Sequence, based on observed residues (ATOM records): (download)

>d2p8mb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgptgpvnamdvwgqgitvt
iss

SCOPe Domain Coordinates for d2p8mb1:

Click to download the PDB-style file with coordinates for d2p8mb1.
(The format of our PDB-style files is described here.)

Timeline for d2p8mb1: