Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (184 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
Domain d2p8lb2: 2p8l B:114-213 [139527] Other proteins in same PDB: d2p8lb1 automatically matched to d2f5ah2 |
PDB Entry: 2p8l (more details), 2.44 Å
SCOPe Domain Sequences for d2p8lb2:
Sequence, based on SEQRES records: (download)
>d2p8lb2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} tstkgpsvfplapsskstaggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvep
>d2p8lb2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} tstkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv vtvpssslqtytcnvnhkpsntkvdkrvep
Timeline for d2p8lb2: