![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.55: DOPA-like [143410] (2 families) ![]() probable biological unit is homodimer; the extra C-terminal strand, adjacent and antiparallel to strand 4, contributes to the dimerisation interface |
![]() | Family d.58.55.1: DOPA dioxygenase-like [143411] (1 protein) Pfam PF08883 |
![]() | Protein Putative dioxygenase BxeB0224 [143412] (1 species) Bxeno_B2751 |
![]() | Species Burkholderia xenovorans [TaxId:36873] [143413] (2 PDB entries) Uniprot Q13JM0 1-115 |
![]() | Domain d2p8ib2: 2p8i B:1-116 [139523] Other proteins in same PDB: d2p8ia3, d2p8ib3, d2p8ic3, d2p8id3 automated match to d2nyha1 complexed with cit, cl, edo, po4 |
PDB Entry: 2p8i (more details), 1.4 Å
SCOPe Domain Sequences for d2p8ib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p8ib2 d.58.55.1 (B:1-116) Putative dioxygenase BxeB0224 {Burkholderia xenovorans [TaxId: 36873]} mtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsyq laftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsaln
Timeline for d2p8ib2: