Lineage for d2p83b1 (2p83 B:61P-385)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060235Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2060236Species Human (Homo sapiens) [TaxId:9606] [50672] (281 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2060570Domain d2p83b1: 2p83 B:61P-385 [139520]
    automatically matched to d1fkna_
    complexed with mr0, po4

Details for d2p83b1

PDB Entry: 2p83 (more details), 2.5 Å

PDB Description: potent and selective isophthalamide s2 hydroxyethylamine inhibitor of bace1
PDB Compounds: (B:) Beta-secretase 1

SCOPe Domain Sequences for d2p83b1:

Sequence, based on SEQRES records: (download)

>d2p83b1 b.50.1.2 (B:61P-385) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
sfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqls
styrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnweg
ilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiig
gidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlp
kkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfr
itilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavs
achvhdefrtaavegpfvtldmedcgyn

Sequence, based on observed residues (ATOM records): (download)

>d2p83b1 b.50.1.2 (B:61P-385) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
sfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqls
styrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnweg
ilglayaeiarpddslepffdslvkqthvpnlfslqlcgaasvggsmiiggidhslytgs
lwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavks
ikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylr
pvedcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaavegpf
vtldmedcgyn

SCOPe Domain Coordinates for d2p83b1:

Click to download the PDB-style file with coordinates for d2p83b1.
(The format of our PDB-style files is described here.)

Timeline for d2p83b1: