Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Engrailed Homeodomain [46691] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries) |
Domain d2p81a_: 2p81 A: [139518] automated match to d2p81a1 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2p81 (more details)
SCOPe Domain Sequences for d2p81a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p81a_ a.4.1.1 (A:) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} akrefnenrylterrrqqlsselglneaqikiwfqnkrakikks
Timeline for d2p81a_: