![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.39: Penicillinase repressor [101016] (2 proteins) homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain |
![]() | Protein Penicillinase repressor BlaI [101019] (2 species) |
![]() | Species Bacillus licheniformis [TaxId:1402] [101020] (2 PDB entries) |
![]() | Domain d2p7cb1: 2p7c B:1-82 [139517] automatically matched to d1p6ra_ |
PDB Entry: 2p7c (more details)
SCOP Domain Sequences for d2p7cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p7cb1 a.4.5.39 (B:1-82) Penicillinase repressor BlaI {Bacillus licheniformis [TaxId: 1402]} mkkipqisdaelevmkviwkhssintnevikelsktstwspktiqtmllrlikkgalnhh kegrvfvytpnidesdyievks
Timeline for d2p7cb1: