Lineage for d2p70a_ (2p70 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325006Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2325007Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 2325078Protein automated matches [190345] (4 species)
    not a true protein
  7. 2325095Species Silkworm (Bombyx mori) [TaxId:7091] [187172] (3 PDB entries)
  8. 2325097Domain d2p70a_: 2p70 A: [139515]
    automated match to d1gm0a_
    complexed with prz

Details for d2p70a_

PDB Entry: 2p70 (more details), 2.1 Å

PDB Description: bombyx mori pheromone binding protein bound to bell pepper odorant
PDB Compounds: (A:) pheromone-binding protein

SCOPe Domain Sequences for d2p70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p70a_ a.39.2.1 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmd

SCOPe Domain Coordinates for d2p70a_:

Click to download the PDB-style file with coordinates for d2p70a_.
(The format of our PDB-style files is described here.)

Timeline for d2p70a_: