Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47532] (8 PDB entries) |
Domain d2p6bd1: 2p6b D:15-160 [139514] Other proteins in same PDB: d2p6ba_, d2p6bc_ automatically matched to d1tcob_ complexed with ca, fe, po4, zn |
PDB Entry: 2p6b (more details), 2.3 Å
SCOPe Domain Sequences for d2p6bd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p6bd1 a.39.1.5 (D:15-160) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} dadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdfkef iegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqivdk tiinadkdgdgrisfeefcavvggld
Timeline for d2p6bd1: