SCOPe 2.06: Domain d2p6bc_: 2p6b C:

Lineage for d2p6bc_ (2p6b C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56315] (5 PDB entries)

8. Domain d2p6bc_: 2p6b C: [139513]
   Other proteins in same PDB: d2p6bb1, d2p6bd1
   automated match to d1m63a_
   complexed with ca, fe, po4, zn

Details for d2p6bc_

PDB Entry: 2p6b, 2.3 Å

PDB Description: crystal structure of human calcineurin in complex with pvivit peptide

PDB Compounds: (C:) Calmodulin-dependent calcineurin A subunit alpha isoform

SCOPe Domain Sequences for d2p6bc_:

Sequence; same for both SEQRES and ATOM records:

>d2p6bc_ d.159.1.3 (C:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]}
tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvln

Timeline for d2p6bc_:

• d2p6bc_ first appeared in SCOP 1.73, called d2p6bc1
  
• d2p6bc_ appears in SCOPe 2.05
  
• d2p6bc_ appears in SCOPe 2.07
  
• d2p6bc_ appears in the current release, SCOPe 2.08