Lineage for d2p66a3 (2p66 A:149-335)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880450Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 880451Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) (S)
  5. 880459Family d.218.1.2: DNA polymerase beta-like [81300] (4 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 880460Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 880461Species Human (Homo sapiens) [TaxId:9606] [81574] (107 PDB entries)
    Uniprot P06746
  8. 880474Domain d2p66a3: 2p66 A:149-335 [139508]
    Other proteins in same PDB: d2p66a1, d2p66a2
    automatically matched to d1bpxa4
    complexed with 3dr, na, po4

Details for d2p66a3

PDB Entry: 2p66 (more details), 2.5 Å

PDB Description: Human DNA Polymerase beta complexed with tetrahydrofuran (abasic site) containing DNA
PDB Compounds: (A:) DNA polymerase beta

SCOP Domain Sequences for d2p66a3:

Sequence, based on SEQRES records: (download)

>d2p66a3 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

Sequence, based on observed residues (ATOM records): (download)

>d2p66a3 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsespkll
hqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycgvly
ftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyrepk
drse

SCOP Domain Coordinates for d2p66a3:

Click to download the PDB-style file with coordinates for d2p66a3.
(The format of our PDB-style files is described here.)

Timeline for d2p66a3: