Lineage for d2p66a1 (2p66 A:7-91)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329042Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329043Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2329044Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 2329045Species Human (Homo sapiens) [TaxId:9606] [47805] (145 PDB entries)
    Uniprot P06746
  8. 2329090Domain d2p66a1: 2p66 A:7-91 [139506]
    Other proteins in same PDB: d2p66a2, d2p66a3
    automated match to d1tv9a1
    protein/DNA complex; complexed with na, po4

Details for d2p66a1

PDB Entry: 2p66 (more details), 2.5 Å

PDB Description: Human DNA Polymerase beta complexed with tetrahydrofuran (abasic site) containing DNA
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d2p66a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p66a1 a.60.6.1 (A:7-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
pqetlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvg
tkiaekideflatgklrklekirqd

SCOPe Domain Coordinates for d2p66a1:

Click to download the PDB-style file with coordinates for d2p66a1.
(The format of our PDB-style files is described here.)

Timeline for d2p66a1: