Lineage for d2p54a1 (2p54 A:202-468)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 648083Protein Peroxisome proliferator activated receptor alpha, PPAR-alpha [69109] (1 species)
  7. 648084Species Human (Homo sapiens) [TaxId:9606] [69110] (4 PDB entries)
  8. 648085Domain d2p54a1: 2p54 A:202-468 [139497]
    automatically matched to d1i7ga_
    complexed with 735

Details for d2p54a1

PDB Entry: 2p54 (more details), 1.79 Å

PDB Description: a crystal structure of PPAR alpha bound with SRC1 peptide and GW735
PDB Compounds: (A:) Peroxisome proliferator-activated receptor alpha

SCOP Domain Sequences for d2p54a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
dlkslakriyeaylknfnmnkvkarvilsgkasnnppfvihdmetlcmaektlvaklvan
giqnkeaevrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifaml
ssvmnkdgmlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfvaa
iiccgdrpgllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvteha
qlvqiikktesdaalhpllqeiyrdmy

SCOP Domain Coordinates for d2p54a1:

Click to download the PDB-style file with coordinates for d2p54a1.
(The format of our PDB-style files is described here.)

Timeline for d2p54a1: