Lineage for d2p4wb1 (2p4w B:1-194)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635895Family a.4.5.64: PF1790-like [140286] (1 protein)
    sequence similarity to PH1932 in the N-terminal domain; the C-terminal domain provides new dimerisation interface made of a beta-hairpin and a coiled coil
  6. 635896Protein Transcriptional regulatory protein PF1790 [140287] (1 species)
  7. 635897Species Pyrococcus furiosus [TaxId:2261] [140288] (1 PDB entry)
  8. 635899Domain d2p4wb1: 2p4w B:1-194 [139496]
    automatically matched to 1XNP A:1-194
    complexed with so4

Details for d2p4wb1

PDB Entry: 2p4w (more details), 2.6 Å

PDB Description: Crystal structure of heat shock regulator from Pyrococcus furiosus
PDB Compounds: (B:) Transcriptional regulatory protein arsR family

SCOP Domain Sequences for d2p4wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4wb1 a.4.5.64 (B:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]}
mgeelnrlldvlgnetrrrilflltkrpyfvselsrelgvgqkavlehlrileeaglies
rvekiprgrprkyymikkglrleilltptlfgsemyeakgvrkspeyeqakeliksqepi
nvkmrelaeflhelnerireiieekreleearilietyientmrrlaeenrqiieeifrd
iekilppgyarslk

SCOP Domain Coordinates for d2p4wb1:

Click to download the PDB-style file with coordinates for d2p4wb1.
(The format of our PDB-style files is described here.)

Timeline for d2p4wb1: