Lineage for d2p4wa_ (2p4w A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983994Family a.4.5.64: PF1790-like [140286] (1 protein)
    sequence similarity to PH1932 in the N-terminal domain; the C-terminal domain provides new dimerisation interface made of a beta-hairpin and a coiled coil
  6. 1983995Protein Transcriptional regulatory protein PF1790 [140287] (1 species)
  7. 1983996Species Pyrococcus furiosus [TaxId:2261] [140288] (2 PDB entries)
    Uniprot Q8U030 1-194
  8. 1983999Domain d2p4wa_: 2p4w A: [139495]
    automated match to d2p4wa1
    complexed with so4

Details for d2p4wa_

PDB Entry: 2p4w (more details), 2.6 Å

PDB Description: Crystal structure of heat shock regulator from Pyrococcus furiosus
PDB Compounds: (A:) Transcriptional regulatory protein arsR family

SCOPe Domain Sequences for d2p4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4wa_ a.4.5.64 (A:) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]}
mgeelnrlldvlgnetrrrilflltkrpyfvselsrelgvgqkavlehlrileeaglies
rvekiprgrprkyymikkglrleilltptlfgsemyeakgvrkspeyeqakeliksqepi
nvkmrelaeflhelnerireiieekreleearilietyientmrrlaeenrqiieeifrd
iekilppgyarslkekf

SCOPe Domain Coordinates for d2p4wa_:

Click to download the PDB-style file with coordinates for d2p4wa_.
(The format of our PDB-style files is described here.)

Timeline for d2p4wa_: