Lineage for d2p4kd2 (2p4k D:84-198)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859482Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 859483Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 859484Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 859610Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)
  7. 859663Species Human (Homo sapiens) [TaxId:9606] [54724] (27 PDB entries)
  8. 859667Domain d2p4kd2: 2p4k D:84-198 [139494]
    Other proteins in same PDB: d2p4ka1, d2p4kb1, d2p4kc1, d2p4kd1
    automatically matched to d1ap5a2
    complexed with mn; mutant

Details for d2p4kd2

PDB Entry: 2p4k (more details), 1.48 Å

PDB Description: contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
PDB Compounds: (D:) superoxide dismutase

SCOP Domain Sequences for d2p4kd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4kd2 d.44.1.1 (D:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d2p4kd2:

Click to download the PDB-style file with coordinates for d2p4kd2.
(The format of our PDB-style files is described here.)

Timeline for d2p4kd2: