Lineage for d2p4kc2 (2p4k C:84-198)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189807Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2189808Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2189809Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2189935Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2189999Species Human (Homo sapiens) [TaxId:9606] [54724] (30 PDB entries)
  8. 2190002Domain d2p4kc2: 2p4k C:84-198 [139492]
    Other proteins in same PDB: d2p4ka1, d2p4kb1, d2p4kc1, d2p4kd1
    automated match to d2p4ka2
    complexed with mn

Details for d2p4kc2

PDB Entry: 2p4k (more details), 1.48 Å

PDB Description: Contribution to Structure and Catalysis of Tyrosine 34 in Human Manganese Superoxide Dismutase
PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d2p4kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4kc2 d.44.1.1 (C:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOPe Domain Coordinates for d2p4kc2:

Click to download the PDB-style file with coordinates for d2p4kc2.
(The format of our PDB-style files is described here.)

Timeline for d2p4kc2: