Lineage for d2p4kc1 (2p4k C:1-83)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1719057Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1719058Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 1719184Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 1719248Species Human (Homo sapiens) [TaxId:9606] [46619] (26 PDB entries)
  8. 1719251Domain d2p4kc1: 2p4k C:1-83 [139491]
    Other proteins in same PDB: d2p4ka2, d2p4kb2, d2p4kc2, d2p4kd2
    automated match to d1pl4a1
    complexed with mn

Details for d2p4kc1

PDB Entry: 2p4k (more details), 1.48 Å

PDB Description: contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d2p4kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4kc1 a.2.11.1 (C:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaanvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOPe Domain Coordinates for d2p4kc1:

Click to download the PDB-style file with coordinates for d2p4kc1.
(The format of our PDB-style files is described here.)

Timeline for d2p4kc1: