SCOP 1.73: Domain d2p3bb1: 2p3b B:1-99

Lineage for d2p3bb1 (2p3b B:1-99)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (230 PDB entries)

8. Domain d2p3bb1: 2p3b B:1-99 [139470]
   automatically matched to d3tlha_
   complexed with 3tl

Details for d2p3bb1

PDB Entry: 2p3b, 2.1 Å

PDB Description: crystal structure of the subtype b wild type hiv protease complexed with tl-3 inhibitor

PDB Compounds: (B:) Gag-Pol polyprotein

SCOP Domain Sequences for d2p3bb1:

Sequence; same for both SEQRES and ATOM records:

>d2p3bb1 b.50.1.1 (B:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d2p3bb1:

• d2p3bb1 is new in SCOP 1.73
  
• d2p3bb1 appears in SCOP 1.75
  
• d2p3bb1 appears in the current release, SCOPe 2.08, called d2p3bb_