Lineage for d2p2lb_ (2p2l B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867551Protein Rac [52595] (1 species)
  7. 2867552Species Human (Homo sapiens) [TaxId:9606] [52596] (41 PDB entries)
  8. 2867571Domain d2p2lb_: 2p2l B: [139466]
    automated match to d1hh4a_
    complexed with gdp, zn

Details for d2p2lb_

PDB Entry: 2p2l (more details), 1.9 Å

PDB Description: rac1-gdp-zinc complex
PDB Compounds: (B:) ras-related c3 botulinum toxin substrate 1

SCOPe Domain Sequences for d2p2lb_:

Sequence, based on SEQRES records: (download)

>d2p2lb_ c.37.1.8 (B:) Rac {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcp

Sequence, based on observed residues (ATOM records): (download)

>d2p2lb_ c.37.1.8 (B:) Rac {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgpvnlglwdtagq
edydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcp

SCOPe Domain Coordinates for d2p2lb_:

Click to download the PDB-style file with coordinates for d2p2lb_.
(The format of our PDB-style files is described here.)

Timeline for d2p2lb_: