Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species) PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56161] (3 PDB entries) |
Domain d2p2ib1: 2p2i B:820-1168 [139464] automatically matched to d1vr2a_ complexed with 608; mutant |
PDB Entry: 2p2i (more details), 2.4 Å
SCOP Domain Sequences for d2p2ib1:
Sequence, based on SEQRES records: (download)
>d2p2ib1 d.144.1.7 (B:820-1168) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh ralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpyk vapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgl ardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgv kideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqana
>d2p2ib1 d.144.1.7 (B:820-1168) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} lpydaskwefprdrlklgkplgrgqvieadafgidktatcrtvavkmlthsehralmsel kilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpykfltlehl icysfqvakgmeflasrkcihrdlaarnillseknvvkicdfplkwmapetifdrvytiq sdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhg epsqrptfselvehlgnllqana
Timeline for d2p2ib1: