Lineage for d2p2ia1 (2p2i A:820-1168)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735481Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 735482Species Human (Homo sapiens) [TaxId:9606] [56161] (3 PDB entries)
  8. 735485Domain d2p2ia1: 2p2i A:820-1168 [139463]
    automatically matched to d1vr2a_
    complexed with 608; mutant

Details for d2p2ia1

PDB Entry: 2p2i (more details), 2.4 Å

PDB Description: crystal structure of the vegfr2 kinase domain in complex with a nicotinamide inhibitor
PDB Compounds: (A:) Vascular endothelial growth factor receptor 2

SCOP Domain Sequences for d2p2ia1:

Sequence, based on SEQRES records: (download)

>d2p2ia1 d.144.1.7 (A:820-1168) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh
ralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpyk
vapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgl
ardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgv
kideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqana

Sequence, based on observed residues (ATOM records): (download)

>d2p2ia1 d.144.1.7 (A:820-1168) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgafgqvieadafgidtcrtvavkmlthsehralmsel
kilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpykvapedly
kdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfglalplkwm
apetifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdytt
pemyqtmldcwhgepsqrptfselvehlgnllqana

SCOP Domain Coordinates for d2p2ia1:

Click to download the PDB-style file with coordinates for d2p2ia1.
(The format of our PDB-style files is described here.)

Timeline for d2p2ia1: