Lineage for d2p2aa_ (2p2a A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144526Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2144535Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (134 PDB entries)
  8. 2144788Domain d2p2aa_: 2p2a A: [139461]
    automated match to d1lb8a_
    complexed with glu, mp9, so4

Details for d2p2aa_

PDB Entry: 2p2a (more details), 2.26 Å

PDB Description: x-ray structure of the glur2 ligand binding core (s1s2j) in complex with 2-bn-tet-ampa at 2.26a resolution
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2p2aa_:

Sequence, based on SEQRES records: (download)

>d2p2aa_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgec

Sequence, based on observed residues (ATOM records): (download)

>d2p2aa_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydgec

SCOPe Domain Coordinates for d2p2aa_:

Click to download the PDB-style file with coordinates for d2p2aa_.
(The format of our PDB-style files is described here.)

Timeline for d2p2aa_: